




|
Resumen del manual
RECYCLING AND REUSE GUIDELINES (Europe) In accordance with the European Union WEEE (Waste Electrical and Electronic Equipment) directive effective August 13, 2005, we would like to notify you that this product may contain regulated materials which, upon disposal, require special reuse and recycling processing. For this reason Paradigm Electronics Inc. (the manufacturer of Paradigm speakers and Anthem electronic products) has arranged with its distributors in European Union member nations to collect and recycle this product at no cost to you. To find your local distributor please contact the dealer from whom you purchased this product or go to our website at Please note that only the product falls under the WEEE directive. When disposing of packaging and other shipping material we encourage you to recycle through the normal channels. Anthem, Sonic Frontiers, and Paradigm are trademarks or registered trademarks of Paradigm Electronics Inc. Copyright Paradigm Electronics Inc. All rights reserved. The information contained herein may not be reproduced in whole or in part without our express written permission. We reserve the right to change specifications and/or features without notice as design improvements are incorporated. 1. INTRODUCTION Thank you for purchasing the Anthem MCA Power Amplifier. MCA series amplifiers are made in 2, 3, and 5-channel versions. Anthem products are engineered to recreate the passion of a live musical performance and thrill of the best movie theaters by using the highest level of circuit design, superior build quality, innovative features, and intuitive ergonomics. 1.1 BEFORE OPERATING THE AMPLIFIER Check that you have received everything in the Packing List below and report any discrepancies to your dealer as soon as possible. Retain all packing materials and use them for any future shipment. Packing List: • Amplifier • Power Cord (North America only) • Operating Manual Keep the invoice that you received from your authorized Anthem dealer at time of purchase – without it, service will not be provided under warranty. Safety Instructions: • Read all safety precautions and instructions at the beginning of this manual. • Do not connect power if there are any signs of damage to any part of the exterior. • The Front Panel power buttons and the Rear Panel switch do not disconnect the product from the AC line. Ensure that the power cord remains readily accessible at all times. • To connect power, only use the supplied double-insulated power cord. • Allow adequate ventilation to ensure reliable operation and to prevent overheating. The amount of space required above the unit for radiation depends on ambient air temperature and circulation. Installation inside a cabinet with a front that can be closed is not recommended unless a fan is also installed to adequately draw air away from the top of the unit. • Failing to comply with any safety instruction, precaution, or warning in this Operating Manual is in direct violation of the standards of design, manufacture, and intended use of the product. • Anthem and any related party assume no liability for the user’s failure to comply with requirements. 1.2 IN-USE NOTICES • Disconnect the power cord before connecting or disconnecting any components. • Do not remove the top cover. • Do not modify the product. 2. CONNECTIONS AND OPERATION 2.1 INPUT CONNECTIONS Balanced XLR connection offers the highest transmission quality, particularly over long cable lengths, because it rejects noise and hum pickup. Note that if an RCA plug is inserted into the RCA jack, that channel’s XLR input is disabled. If your preamplifier does not have XLR outputs, use the Single-Ended RCA inputs. Do not use ‘RCA-compatible’ connectors that have a hollow center pin with a hole at the tip – inserting them into the MCA amplifier’s RCA jacks can cause internal damage. 2.2 SPEAKER CONNECTIONS Dependingontheleveloftheinputsignal,thevoltageattheoutputscanbehighenoughtocauseelectricshock–besurethatpoweristurnedoffwhenconnectingordisconnectinganything.Aswell,besurethatthespeakersareratedforusewiththisamplifier–anoverdrivenspeakercanposeafirehazard. Connectthered(+)connectiononthespeakertothered(+)bindingpostontheappropriateamplifierchannel,andtheblack(–)connectiononthespeakertotheblack(–)bindingpostonthesameamplifierchannel,usingcablethatisinsulatedtohandlethemaximumoutputoftheamplifier.Donotovertightenthebindingpostsasthismaycausedamage.Eachbindingpostacceptsaconnectionfromonespeaker. 2.3ONMODESWiththethree-wayswitchlocatedontherearpanel,youcansetthewaytheamplifieristurnedonandoff. TouseTrigger-On,connectastandard3.5mm(.125”)monominiplugcablebetweentheamplifierandthepreamplifierorcontrolcomponent.Onceallotherconnectionsaremade,connectthepowercordtotheamplifierandthenthewalloutlet.Some‘clicks’shouldbeheardfromrelaysinsidetheamplifierafewsecondsafterpoweristurnedon. Manual-On: Wheninthisposition,theamplifieristurnedon/offviathepowerbuttononthefrontpanel. Trigger-On:...
Otros modelos de este manual:El receptor y el amplificador - MCA 30 (268.3 kb)
El receptor y el amplificador - MCA 50 (268.3 kb)